PDB entry 2ij0

View 2ij0 on RCSB PDB site
Description: Structural basis of T cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1
Class: protein binding
Keywords: Superantigen, Protein-protein interaction, X-ray crystallography
Deposited on 2006-09-28, released 2007-02-20
The last revision prior to the SCOP 1.73 freeze date was dated 2007-03-06, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.242
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ij0a1, d2ij0a2
  • Chain 'B':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ij0b1, d2ij0b2
  • Chain 'C':
    Compound: penultimate affinity-matured variant of hVbeta 2.1, D10
    Species: HOMO SAPIENS
  • Chain 'E':
    Compound: penultimate affinity-matured variant of hVbeta 2.1, D10
    Species: HOMO SAPIENS
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ij0A (A:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ij0A (A:)
    dnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkgekvd
    lntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfdkkq
    laistldfeirhqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekppini
    deiktieaein
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ij0B (B:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    No sequence available.