PDB entry 2iiz

View 2iiz on RCSB PDB site
Description: Crystal structure of putative melanin biosynthesis protein TyrA with bound heme (NP_716371.1) from Shewanella Oneidensis at 2.30 A resolution
Class: Structural Genomics/Unknown function
Keywords: NP_716371.1, putative melanin biosynthesis protein TyrA, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, Structural Genomics-Unknown function COMPLEX
Deposited on 2006-09-28, released 2006-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Melanin biosynthesis protein TyrA, putative
    Species: Shewanella oneidensis [TaxId:70863]
    Gene: np_716371.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EIU4
      • modified residue (6)
      • modified residue (25)
      • modified residue (81)
      • modified residue (88)
      • modified residue (124)
      • modified residue (141)
      • modified residue (245)
      • modified residue (256)
      • modified residue (270)
      • modified residue (274)
      • modified residue (287)
      • modified residue (307)
    Domains in SCOPe 2.07: d2iiza_
  • Heterogens: NA, HEM, EDO, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iizA (A:)
    gmdiqnmpreqlgvcaegnlhsvylmfnandnvesqlrpcianvaqyiyeltdqysdsaf
    ngfvaiganywdslypesrpemlkpfpamqegnreapaieydlfvhlrcdrydilhlvan
    eisqmfedlvelveeergfrfmdsrdltgfvdgtenpkgrhrqevalvgsedpefkggsy
    ihvqkyahnlskwhrlplkkqediigrtkqdnieyesedkpltshikrvnlkdengksie
    ilrqsmpygslkeqglmfistcrtpdhfekmlhsmvfgdgagnhdhlmhftsaltgssff
    apsldflmqfdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iizA (A:)
    nmpreqlgvcaegnlhsvylmfnandnvesqlrpcianvaqyiyeltdqysdsafngfva
    iganywdslypesrpemlkpfpamqegnreapaieydlfvhlrcdrydilhlvaneisqm
    fedlvelveeergfrfmdsrdltgfvdgtenpkgrhrqevalvgsedpefkggsyihvqk
    yahnlskwhrlplkkqediigrtkqdnieyesedkpltshikrvnlkdengksieilrqs
    mpygslkeqglmfistcrtpdhfekmlhsmvfgdgagnhdhlmhftsaltgssffapsld
    flmqfd