PDB entry 2iij

View 2iij on RCSB PDB site
Description: Structure of human Asf1a in complex with histone H3
Class: chaperone
Keywords: protein-protein complex, CHAPERONE
Deposited on 2006-09-28, released 2007-02-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ASF1A protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ASF1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2iija1
  • Chain 'B':
    Compound: histone h3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IIJ (0-17)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2iijA (A:)
gamakvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvld
svlvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneyt
etelrenppvkpdfsklqrnilasnprvtrfhinwedn

    Sequence, based on observed residues (ATOM records): (download) 
    >2iijA (A:)
makvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvldsv
lvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneytet
elrenppvkpdfsklqrnilasnprvtrfhinwedn

  • Chain 'B':
    No sequence available.