PDB entry 2iia

View 2iia on RCSB PDB site
Description: Anabaena sensory rhodopsin transducer
Class: signaling protein
Keywords: rhodopsin, transducer, SIGNALING PROTEIN
Deposited on 2006-09-27, released 2007-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensory rhodopsin transducer protein
    Species: Anabaena sp. [TaxId:1167]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2iiaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iiaA (A:)
    mhhhhhhslsigrtcwaiaegyippygngpepqfishetvcilnagdedahveitiyysd
    kepvgpyrltvparrtkhvrfndlndpapiphdtdfasviqsnvpivvqhtrldsrqaen
    allstiayant
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iiaA (A:)
    igrtcwaiaegyippetvcilnagdedahveitiyysdkepvgpyrltvparrtkhvrfn
    dlndpapiphdtdfasviqsnvpivvqht