PDB entry 2ihu

View 2ihu on RCSB PDB site
Description: Carboxyethylarginine synthase from Streptomyces clavuligerus: putative reaction intermediate complex
Class: Transferase
Keywords: Thiamin diphosphate complex, Transferase
Deposited on 2006-09-27, released 2007-11-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.172
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Gene: ceas2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ihua1, d2ihua2, d2ihua3
  • Chain 'B':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Gene: ceas2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ihub1, d2ihub2, d2ihub3
  • Chain 'C':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Gene: ceas2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ihuc1, d2ihuc2, d2ihuc3
  • Chain 'D':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Gene: ceas2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ihud1, d2ihud2, d2ihud3
  • Heterogens: MG, K, TP9, TP8, TAR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ihuA (A:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihuA (A:)
    kptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlari
    tgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaiva
    pmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppant
    pakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvitt
    yiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkg
    iekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariae
    fladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfl
    tsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnn
    dtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelg
    rpflievpvnydfqpggfgals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ihuB (B:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihuB (B:)
    kptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlari
    tgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaiva
    pmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppant
    pakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvitt
    yiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkg
    iekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariae
    fladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfl
    tsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnn
    dtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelg
    rpflievpvnyd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ihuC (C:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihuC (C:)
    kptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlari
    tgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaiva
    pmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppant
    pakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvitt
    yiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkg
    iekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariae
    fladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfl
    tsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnn
    dtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelg
    rpflievpvny
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ihuD (D:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihuD (D:)
    kptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlari
    tgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaiva
    pmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppant
    pakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvitt
    yiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkg
    iekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariae
    fladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfl
    tsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnn
    dtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelg
    rpflievpvny