PDB entry 2iht

View 2iht on RCSB PDB site
Description: Carboxyethylarginine synthase from Streptomyces clavuligerus: SeMet structure
Class: transferase
Keywords: Thiamin diphosphate complex, TRANSFERASE
Deposited on 2006-09-27, released 2007-09-18
The last revision prior to the SCOP 1.75 freeze date was dated 2007-11-27, with a file datestamp of 2007-11-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.154
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus
    Gene: ceas2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCV9 (Start-572)
      • modified residue (84)
      • modified residue (131)
      • modified residue (156)
      • modified residue (271)
      • modified residue (283)
      • modified residue (305)
      • modified residue (381)
      • modified residue (390)
      • modified residue (394)
      • modified residue (449)
    Domains in SCOP 1.75: d2ihta1, d2ihta2, d2ihta3
  • Chain 'B':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus
    Gene: ceas2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCV9 (Start-572)
      • modified residue (84)
      • modified residue (131)
      • modified residue (156)
      • modified residue (271)
      • modified residue (283)
      • modified residue (305)
      • modified residue (381)
      • modified residue (390)
      • modified residue (394)
      • modified residue (449)
    Domains in SCOP 1.75: d2ihtb1, d2ihtb2, d2ihtb3
  • Chain 'C':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus
    Gene: ceas2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCV9 (Start-572)
      • modified residue (84)
      • modified residue (131)
      • modified residue (156)
      • modified residue (271)
      • modified residue (283)
      • modified residue (305)
      • modified residue (381)
      • modified residue (390)
      • modified residue (394)
      • modified residue (449)
    Domains in SCOP 1.75: d2ihtc1, d2ihtc2, d2ihtc3
  • Chain 'D':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus
    Gene: ceas2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCV9 (Start-572)
      • modified residue (84)
      • modified residue (131)
      • modified residue (156)
      • modified residue (271)
      • modified residue (283)
      • modified residue (305)
      • modified residue (381)
      • modified residue (390)
      • modified residue (394)
      • modified residue (449)
    Domains in SCOP 1.75: d2ihtd1, d2ihtd2, d2ihtd3
  • Heterogens: MG, SO4, TPP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ihtA (A:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihtA (A:)
    kptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlari
    tgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaiva
    pmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidpnppantpak
    pvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyia
    kgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiek
    ktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaefla
    dpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsa
    gcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtn
    glielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpf
    lievpvnydfqpggfgalsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ihtB (B:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihtB (B:)
    kptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlari
    tgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaiva
    pmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidtpnppantpa
    kpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyi
    akgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgie
    kktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaefl
    adpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgflts
    agcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndt
    nglielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrp
    flievpvnydfqpggfgalsi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ihtC (C:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihtC (C:)
    kptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlari
    tgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaiva
    pmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidnppantpakp
    vgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiak
    gvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekk
    tvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaeflad
    petyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsag
    cssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtng
    lielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpfl
    ievpvnydfqpggfgalsi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ihtD (D:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihtD (D:)
    kptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlari
    tgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaiva
    pmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidnppantpakp
    vgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiak
    gvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekk
    tvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaeflad
    petyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsag
    cssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtng
    lielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpfl
    ievpvnydfqpggfgalsi