PDB entry 2ihr

View 2ihr on RCSB PDB site
Description: RF2 of Thermus thermophilus
Class: translation
Keywords: mixed alpha-beta, TRANSLATION
Deposited on 2006-09-27, released 2007-02-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.269
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Peptide chain release factor 2
    Species: Thermus thermophilus [TaxId:274]
    Gene: YP_005821
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SM01 (13-End)
      • cloning artifact (5-12)
    Domains in SCOPe 2.01: d2ihr1_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >2ihr1 (1:)
    mdlerlaqrleglggifdipqketrlkelerrledpslwndpeaarkvsqeaarlrrtvd
    tfrslesdlqgllelmeelpaeerealkpeleeaakkldelyhqtllnfphaeknailti
    qpgaggteacdwaemllrmytrfaerqgfqvevvdltpgpeagidyaqilvkgenaygll
    speagvhrlvrpspfdasgrrhtsfagvevipevdeevevvlkpeelridvmrasgpggq
    gvnttdsavrvvhlptgitvtcqttrsqiknkelalkilkarlyelerkkreeelkalrg
    evrpiewgsqirsyvldknyvkdhrtglmrhdpenvldgdlmdliwaglewkagrrqgte
    eveae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihr1 (1:)
    laqrleglggifdipqketrlkelerrledpslwndpeaarkvsqeaarlrrtvdtfrsl
    esdlqgllelmeelpaeerealkpeleeaakkldelyhqtllnfphaeknailtiqpgag
    gteacdwaemllrmytrfaerqgfqvevvdltpgpeagidyaqilvkgenaygllspeag
    vhrlvrpspfdasgrrhtsfagvevipevdeevevvlkpeelridvmrasgpggqgvntt
    dsavrvvhlptgitvtcqttrsqiknkelalkilkarlyelerkkreeelkalrgevrpi
    ewgsqirsyvldknyvkdhrtglmrhdpenvldgdlmdliwaglewkagrr