PDB entry 2ihp

View 2ihp on RCSB PDB site
Description: Yeast inorganic pyrophosphatase with magnesium and phosphate
Class: Hydrolase
Keywords: Inorganic pyrophosphatase, mechanism, x-ray crystallography, structure-function, mutagenesis, Hydrolase
Deposited on 2006-09-27, released 2007-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.163
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IPP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ihpa_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IPP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ihpb_
  • Heterogens: MG, PO4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ihpA (A:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaslkadapidksidkwffisgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihpA (A:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnavgdndpidvleiget
    iaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpgllratne
    wfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgidltnvtl
    pdtptyskaasdaippaslkadapidksidkwffi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ihpB (B:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaslkadapidksidkwffisgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihpB (B:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaslkadapidksidkwffis