PDB entry 2ihn

View 2ihn on RCSB PDB site
Description: Co-crystal of Bacteriophage T4 RNase H with a fork DNA substrate
Class: hydrolase/DNA
Keywords: BPT4 RNase H, protein:DNA complex, 5'-3' exonuclease, Hydrolase (nucleic acid), helix-hairpin-helix motif type 2 (HhH2), fork DNA, HYDROLASE/DNA COMPLEX
Deposited on 2006-09-26, released 2007-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.225
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease H
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: rnh, 33.2, das
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13319 (0-304)
      • engineered (131)
    Domains in SCOPe 2.07: d2ihna1, d2ihna2
  • Chain 'C':
    Compound: 5'-d(*cp*tp*ap*ap*cp*tp*tp*tp*gp*ap*gp*gp*cp*ap*gp*ap*cp*c)-3'
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 5'-d(*gp*gp*tp*cp*tp*gp*cp*cp*tp*cp*ap*ap*gp*ap*cp*gp*gp*tp*ap*gp*tp*cp*ap*a)-3'
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ihnA (A:)
    mdlemmldedykegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkakt
    lgytkivlcidnaksgywrrdfayyykknrgkareestwdwegyfesshkvidelkaymp
    yivmdidkyeandhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki
    ksgsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqak
    vllteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltn
    sinef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihnA (A:)
    mdlemmldedykegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkakt
    lgytkivlcidnaksgywrrdfayyykknrstwdwegyfesshkvidelkaympyivmdi
    dkyeandhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvkiksgsae
    idcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqakvlltes
    eynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltnsinef
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.