PDB entry 2ihm

View 2ihm on RCSB PDB site
Description: Polymerase mu in ternary complex with gapped 11mer DNA duplex and bound incoming nucleotide
Class: Transferase/DNA
Keywords: polymerase, helix-turn-helix, Transferase-DNA COMPLEX
Deposited on 2006-09-26, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase mu
    Species: Mus musculus [TaxId:10090]
    Gene: Polm
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JIW4 (0-359)
      • variation (249)
    Domains in SCOPe 2.07: d2ihma1, d2ihma2, d2ihma3
  • Chain 'B':
    Compound: DNA polymerase mu
    Species: Mus musculus [TaxId:10090]
    Gene: Polm
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ihmb1, d2ihmb2, d2ihmb3
  • Chain 'D':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'E':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'P':
    Compound: 5'-d(*cp*ap*gp*tp*ap*t)-3'
  • Chain 'Q':
    Compound: 5'-d(*cp*ap*gp*tp*ap*t)-3'
  • Chain 'T':
    Compound: 5'-d(*cp*gp*gp*cp*ap*ap*tp*ap*cp*tp*g)-3'
  • Chain 'U':
    Compound: 5'-d(*cp*gp*gp*cp*ap*ap*tp*ap*cp*tp*g)-3'
  • Heterogens: MG, NA, D3T, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ihmA (A:)
    smpayacqrpsplthhntllsealetlaeaagfeanegrllsfsraasvlkslpcpvasl
    sqlhglpyfgehstrviqellehgtceevkqvrcseryqtmklftqvfgvgvktanrwyq
    eglrtldelreqpqrltqqqkaglqyyqdlstpvrradaealqqlieaavrqtlpgatvt
    ltggfrrgklqghdvdflithpeegqevgllpkvmsclqsqglvlyhqyhrshladsahn
    lrqrsstmdvfersfcilglpqpqqaalagalppcptwkavrvdlvvtpssqfpfallgw
    tgsqfferelrrfsrqekglwlnshglfdpeqkrvfhatseedvfrllglkylppeqrna
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihmA (A:)
    smpayacqrpsplthhntllsealetlaeaagfeanegrllsfsraasvlkslpcpvasl
    sqlhglpyfgehstrviqellehgtceevkqvrcseryqtmklftqvfgvgvktanrwyq
    eglrtldelreqpqrltqqqkaglqyyqdlstpvrradaealqqlieaavrqtlpgatvt
    ltggfrrgklqghdvdflithpeegqevgllpkvmsclqsqglvlyhqyhrshdvfersf
    cilglpqptwkavrvdlvvtpssqfpfallgwtgsqfferelrrfsrqekglwlnshglf
    dpeqkrvfhatseedvfrllglkylppeqrna
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ihmB (B:)
    smpayacqrpsplthhntllsealetlaeaagfeanegrllsfsraasvlkslpcpvasl
    sqlhglpyfgehstrviqellehgtceevkqvrcseryqtmklftqvfgvgvktanrwyq
    eglrtldelreqpqrltqqqkaglqyyqdlstpvrradaealqqlieaavrqtlpgatvt
    ltggfrrgklqghdvdflithpeegqevgllpkvmsclqsqglvlyhqyhrshladsahn
    lrqrsstmdvfersfcilglpqpqqaalagalppcptwkavrvdlvvtpssqfpfallgw
    tgsqfferelrrfsrqekglwlnshglfdpeqkrvfhatseedvfrllglkylppeqrna
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihmB (B:)
    smpayacqrpsplthhntllsealetlaeaagfeanegrllsfsraasvlkslpcpvasl
    sqlhglpyfgehstrviqellehgtceevkqvrcseryqtmklftqvfgvgvktanrwyq
    eglrtldelreqpqrltqqqkaglqyyqdlstpvrradaealqqlieaavrqtlpgatvt
    ltggfrrgklqghdvdflithpeegqevgllpkvmsclqsqglvlyhqyfersfcilglp
    qpqqagalppcptwkavrvdlvvtpssqfpfallgwtgsqfferelrrfsrqekglwlns
    hglfdpeqkrvfhatseedvfrllglkylppeqrna
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.