PDB entry 2ihf

View 2ihf on RCSB PDB site
Description: Crystal structure of deletion mutant delta 228-252 R190A of the single-stranded DNA binding protein from Thermus aquaticus
Class: DNA binding protein
Keywords: Single-stranded DNA binding protein (SSB), Thermophile organism, Protein-DNA interaction, Protein-protein interaction, DNA BINDING PROTEIN
Deposited on 2006-09-26, released 2007-01-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.222
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-stranded DNA-binding protein
    Species: Thermus aquaticus [TaxId:271]
    Gene: ssb
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KH06 (0-End)
      • engineered (189)
    Domains in SCOPe 2.04: d2ihfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ihfA (A:)
    marglnqvfligtltarpdmrytpgglaildlnlagqdaftdesgqerevpwyhrvrllg
    rqaemwgdllekgqlifvegrleyrqwekdgekksevqvraefidplegrgretledarg
    qprlrralnqvilmgnltrdpdlrytpqgtavvrlglavnerrrgqeeerthflevqawr
    elaewaselakgdgllvigrlvndswtsssgerrfqtrvealrlerpledfppeedlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihfA (A:)
    marglnqvfligtltarpdmrytpgglaildlnlagqdaftdesgqerevpwyhrvrllg
    rqaemwgdllekgqlifvegrleyrqwekdgekksevqvraefidplegrgralnqvilm
    gnltrdpdlrytpqgtavvrlglavneerthflevqawrelaewaselakgdgllvigrl
    vndrfqtrvealrlerpledfppee