PDB entry 2ihd

View 2ihd on RCSB PDB site
Description: Crystal structure of Human Regulator of G-protein signaling 8, RGS8
Class: signaling protein
Keywords: RGS8; RGS; signaling protein, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2006-09-26, released 2006-11-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.177
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of G-protein signaling 8
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ihda_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ihdA (A:)
    mhhhhhhssgvdlgtenlyfqsmlkrlsteeatrwadsfdvllshkygvaafraflktef
    seenlefwlaceefkktrstaklvskahrifeefvdvqaprevnidfqtreatrknlqep
    sltcfdqaqgkvhslmekdsyprflrskmyldlls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihdA (A:)
    steeatrwadsfdvllshkygvaafraflktefseenlefwlaceefkktrstaklvska
    hrifeefvdvqaprevnidfqtreatrknlqepsltcfdqaqgkvhslmekdsyprflrs
    kmyldll