PDB entry 2ihb

View 2ihb on RCSB PDB site
Description: Crystal structure of the heterodimeric complex of human RGS10 and activated Gi alpha 3
Class: signaling protein
Keywords: G protein signalling, RGS, heterotrimeric G protein, signalling complex, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2006-09-26, released 2006-11-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.209
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide-binding protein G(k) subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: GNAI3
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Regulator of G-protein signalling 10
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ihbb_
  • Heterogens: ALF, MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2ihbB (B:)
smsrkrppsdihdsdgssssshqslkstakwaaslenlledpegvkrfreflkkefseen
vlfwlacedfkkmqdktqmqekakeiymtflsskassqvnvegqsrlnekileephplmf
qklqdqifnlmkydsysrflksdlflkhkrtee

    Sequence, based on observed residues (ATOM records): (download) 
    >2ihbB (B:)
lkstakwaaslenlledpegvkrfreflkkefseenvlfwlacedfkkmqdktqmqekak
eiymtflsskassqvnvegphplmfqklqdqifnlmkydsysrflksdlfl