PDB entry 2ih1

View 2ih1 on RCSB PDB site
Description: Ion selectivity in a semi-synthetic K+ channel locked in the conductive conformation
Class: membrane protein
Keywords: Ion channel D-Amino acid semi-synthetic, MEMBRANE PROTEIN
Deposited on 2006-09-25, released 2006-11-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.233
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IH1 (0-218)
    Domains in SCOPe 2.06: d2ih1a1, d2ih1a2
  • Chain 'B':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IH1 (0-211)
    Domains in SCOPe 2.06: d2ih1b1, d2ih1b2
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (Start-121)
      • engineered (68-69)
      • modified residue (76)
    Domains in SCOPe 2.06: d2ih1c_
  • Heterogens: K, 1EM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ih1A (A:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ih1B (B:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ih1C (C:)
    mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwacetattvaygdlypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqe
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ih1C (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwacetattvaygdl
    ypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqerr