PDB entry 2igy

View 2igy on RCSB PDB site
Description: Achiral, Cheap and Potent Inhibitors of Plasmepsins II
Class: hydrolase
Keywords: achiral inhibitor, HYDROLASE
Deposited on 2006-09-25, released 2006-11-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.214
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasmepsin-2
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2igya_
  • Chain 'B':
    Compound: Plasmepsin-2
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2igyb_
  • Heterogens: A2T, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2igyA (A:)
    ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
    sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
    dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
    pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
    flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
    lgdpfmrkyftvfdydnhsvgialakknl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2igyB (B:)
    ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
    sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
    dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
    pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
    flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
    lgdpfmrkyftvfdydnhsvgialakknl