PDB entry 2igw

View 2igw on RCSB PDB site
Description: CYCLOPHILIN 3 complexed with DIPEPTIDE GLY-PRO
Class: isomerase
Keywords: isomerase, rotamase
Deposited on 2006-09-25, released 2007-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.225
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase 3
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2igwa_
  • Heterogens: GLY, PRO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2igwA (A:)
    msrskvffditiggkasgrivmelyddvvpktagnfralctgengigksgkplhfkgskf
    hriipnfmiqggdftrgngtggesiygekfpdenfkekhtgpgvlsmanagpntngsqff
    lctvktewldgkhvvfgrvvegldvvkavesngsqsgkpvkdcmiadcgqlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2igwA (A:)
    msrskvffditiggkasgrivmelyddvvpktagnfralctgengigksgkplhfkgskf
    hriipnfmiqggdftrgngtggesiygekfpdenfkekhtgpgvlsmanagpntngsqff
    lctvktewldgkhvvfgrvvegldvvkavesngsqsgkpvkdcmiadcgqlk