PDB entry 2igt

View 2igt on RCSB PDB site
Description: Crystal Structure of the SAM Dependent Methyltransferase from Agrobacterium tumefaciens
Class: transferase
Keywords: alpha-beta sandwich, beta-barrel, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2006-09-25, released 2006-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SAM dependent methyltransferase
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UIF7 (21-329)
      • cloning artifact (14-20)
      • modified residue (21)
      • modified residue (97)
      • modified residue (212)
      • modified residue (253)
      • modified residue (282)
      • modified residue (286)
      • modified residue (290)
    Domains in SCOPe 2.07: d2igta1, d2igta2
  • Chain 'B':
    Compound: SAM dependent methyltransferase
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UIF7 (21-329)
      • cloning artifact (14-20)
      • modified residue (21)
      • modified residue (97)
      • modified residue (212)
      • modified residue (253)
      • modified residue (282)
      • modified residue (286)
      • modified residue (290)
    Domains in SCOPe 2.07: d2igtb2, d2igtb3
  • Chain 'C':
    Compound: SAM dependent methyltransferase
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UIF7 (21-329)
      • cloning artifact (14-20)
      • modified residue (21)
      • modified residue (97)
      • modified residue (212)
      • modified residue (253)
      • modified residue (282)
      • modified residue (286)
      • modified residue (290)
    Domains in SCOPe 2.07: d2igtc2, d2igtc3
  • Heterogens: SAM, GOL, ACY, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2igtA (A:)
    mgsshhhhhhssgrenlyfqgmqrtgelpaehvpvilessgagdfhlidsgnglkleqyg
    dyrvvrpeaqalwrplvpdrvwqnadaiftgdtdedgmgrwrfpkealgetwplsllgve
    flgrftafrhvgvfpeqivhwewlknavetadrplkvlnlfgytgvaslvaaaagaevth
    vdaskkaigwakenqvlagleqapirwicedamkfiqreerrgstydiiltdppkfgrgt
    hgevwqlfdhlplmldicreilspkalglvltaysirasfysmhelmretmrgaggvvas
    gelvireagldgktpgrvlstslfsrwepkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2igtA (A:)
    enlyfqgmqrtgelpaehvpvilessgagdfhlidsgnglkleqygdyrvvrpeaqalwr
    plvpdrvwqnadaiftgdtgmgrwrfpkealgetwplsllgveflgrftafrhvgvfpeq
    ivhwewlknavetadrplkvlnlfgytgvaslvaaaagaevthvdaskkaigwakenqvl
    agleqapirwicedamkfiqreerrgstydiiltdppkfgrgthgevwqlfdhlplmldi
    creilspkalglvltaysirasfysmhelmretmrgaggvvasgelvireagldgktpgr
    vlstslfsrwepk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2igtB (B:)
    mgsshhhhhhssgrenlyfqgmqrtgelpaehvpvilessgagdfhlidsgnglkleqyg
    dyrvvrpeaqalwrplvpdrvwqnadaiftgdtdedgmgrwrfpkealgetwplsllgve
    flgrftafrhvgvfpeqivhwewlknavetadrplkvlnlfgytgvaslvaaaagaevth
    vdaskkaigwakenqvlagleqapirwicedamkfiqreerrgstydiiltdppkfgrgt
    hgevwqlfdhlplmldicreilspkalglvltaysirasfysmhelmretmrgaggvvas
    gelvireagldgktpgrvlstslfsrwepkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2igtB (B:)
    enlyfqgmqrtgelpaehvpvilessgagdfhlidsgnglkleqygdyrvvrpeaqalwr
    plvpdrvwqnadaiftgdgmgrwrfpkealgetwplsllgveflgrftafrhvgvfpeqi
    vhwewlknavetadrplkvlnlfgytgvaslvaaaagaevthvdaskkaigwakenqvla
    gleqapirwicedamkfiqreerrgstydiiltdppkfgrgthgevwqlfdhlplmldic
    reilspkalglvltaysirasfysmhelmretmrgaggvvasgelvireagldgktpgrv
    lstslfsrwepk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2igtC (C:)
    mgsshhhhhhssgrenlyfqgmqrtgelpaehvpvilessgagdfhlidsgnglkleqyg
    dyrvvrpeaqalwrplvpdrvwqnadaiftgdtdedgmgrwrfpkealgetwplsllgve
    flgrftafrhvgvfpeqivhwewlknavetadrplkvlnlfgytgvaslvaaaagaevth
    vdaskkaigwakenqvlagleqapirwicedamkfiqreerrgstydiiltdppkfgrgt
    hgevwqlfdhlplmldicreilspkalglvltaysirasfysmhelmretmrgaggvvas
    gelvireagldgktpgrvlstslfsrwepkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2igtC (C:)
    enlyfqgmqrtgelpaehvpvilessgagdfhlidsgnglkleqygdyrvvrpeaqalwr
    plvpdrvwqnadaiftgddgmgrwrfpkealgetwplsllgveflgrftafrhvgvfpeq
    ivhwewlknavetadrplkvlnlfgytgvaslvaaaagaevthvdaskkaigwakenqvl
    agleqapirwicedamkfiqreerrgstydiiltdppkfgrgthgevwqlfdhlplmldi
    creilspkalglvltaysirasfysmhelmretmrgaggvvasgelvireagldgktpgr
    vlstslfsrwepk