PDB entry 2igs

View 2igs on RCSB PDB site
Description: Crystal Structure of the Protein of Unknown Function from Pseudomonas aeruginosa
Class: structural genomics, unknown function
Keywords: helix-bundles, alpha-beta, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-09-25, released 2006-10-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.194
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I1P7 (Start-216)
      • modified residue (82)
      • modified residue (101)
      • modified residue (166)
      • cloning artifact (217-218)
    Domains in SCOPe 2.01: d2igsa1
  • Chain 'B':
    Compound: hypothetical protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I1P7 (Start-216)
      • modified residue (82)
      • modified residue (101)
      • modified residue (166)
    Domains in SCOPe 2.01: d2igsb_
  • Chain 'C':
    Compound: hypothetical protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I1P7 (Start-216)
      • modified residue (82)
      • modified residue (101)
      • modified residue (166)
      • cloning artifact (217)
    Domains in SCOPe 2.01: d2igsc_
  • Chain 'D':
    Compound: hypothetical protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I1P7 (Start-216)
      • modified residue (82)
      • modified residue (101)
      • modified residue (166)
      • cloning artifact (217)
    Domains in SCOPe 2.01: d2igsd_
  • Chain 'E':
    Compound: hypothetical protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I1P7 (Start-216)
      • modified residue (82)
      • modified residue (101)
      • modified residue (166)
      • cloning artifact (217)
    Domains in SCOPe 2.01: d2igse_
  • Chain 'F':
    Compound: hypothetical protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I1P7 (Start-216)
      • modified residue (82)
      • modified residue (101)
      • modified residue (166)
      • cloning artifact (217)
    Domains in SCOPe 2.01: d2igsf_
  • Chain 'G':
    Compound: hypothetical protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I1P7 (Start-216)
      • modified residue (82)
      • modified residue (101)
      • modified residue (166)
      • cloning artifact (217-218)
    Domains in SCOPe 2.01: d2igsg_
  • Chain 'H':
    Compound: hypothetical protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I1P7 (Start-216)
      • modified residue (82)
      • modified residue (101)
      • modified residue (166)
      • cloning artifact (217-218)
    Domains in SCOPe 2.01: d2igsh_
  • Heterogens: SO4, ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2igsA (A:)
    ghmaeiniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdisk
    adqqystllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldr
    fkgspnvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpg
    vglrldapnfsdvfntiksglryttavtlllayfaaigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2igsA (A:)
    iniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadqqy
    stllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkgsp
    nvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvglrl
    dapnfsdvfntiksglryttavtlllayfaaigs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2igsB (B:)
    ghmaeiniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdisk
    adqqystllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldr
    fkgspnvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpg
    vglrldapnfsdvfntiksglryttavtlllayfaaigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2igsB (B:)
    aeiniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadq
    qystllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkg
    spnvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvgl
    rldapnfsdvfntiksglryttavtlllayfaai
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2igsC (C:)
    ghmaeiniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdisk
    adqqystllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldr
    fkgspnvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpg
    vglrldapnfsdvfntiksglryttavtlllayfaaigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2igsC (C:)
    iniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadqqy
    stllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkgsp
    nvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvglrl
    dapnfsdvfntiksglryttavtlllayfaaig
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2igsD (D:)
    ghmaeiniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdisk
    adqqystllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldr
    fkgspnvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpg
    vglrldapnfsdvfntiksglryttavtlllayfaaigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2igsD (D:)
    iniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadqqy
    stllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkgsp
    nvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvglrl
    dapnfsdvfntiksglryttavtlllayfaaig
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2igsE (E:)
    ghmaeiniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdisk
    adqqystllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldr
    fkgspnvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpg
    vglrldapnfsdvfntiksglryttavtlllayfaaigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2igsE (E:)
    einiyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadqq
    ystllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkgs
    pnvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvglr
    ldapnfsdvfntiksglryttavtlllayfaaig
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2igsF (F:)
    ghmaeiniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdisk
    adqqystllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldr
    fkgspnvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpg
    vglrldapnfsdvfntiksglryttavtlllayfaaigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2igsF (F:)
    aeiniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadq
    qystllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkg
    spnvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvgl
    rldapnfsdvfntiksglryttavtlllayfaaig
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2igsG (G:)
    ghmaeiniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdisk
    adqqystllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldr
    fkgspnvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpg
    vglrldapnfsdvfntiksglryttavtlllayfaaigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2igsG (G:)
    iniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadqqy
    stllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkgsp
    nvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvglrl
    dapnfsdvfntiksglryttavtlllayfaaigs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2igsH (H:)
    ghmaeiniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdisk
    adqqystllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldr
    fkgspnvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpg
    vglrldapnfsdvfntiksglryttavtlllayfaaigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2igsH (H:)
    iniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadqqy
    stllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkgsp
    nvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvglrl
    dapnfsdvfntiksglryttavtlllayfaaigs