PDB entry 2igh

View 2igh on RCSB PDB site
Description: determination of the solution structures of domains II and III of protein g from streptococcus by 1h nmr
Class: immunoglobulin-binding protein
Keywords: immunoglobulin-binding protein
Deposited on 1992-08-26, released 1994-01-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein g
    Species: Streptococcus sp. GX7805 [TaxId:1325]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2igha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ighA (A:)
    ltpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvt
    e