PDB entry 2igg

View 2igg on RCSB PDB site
Description: determination of the solution structures of domains ii and iii of protein g from streptococcus by 1h nmr
Deposited on 1992-08-26, released 1994-01-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2igg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2igg_ (-)
    ltpavttyklvingktlkgettteavdaataekvfkqyandngvdgewtyddatktftvt
    ekpe