PDB entry 2igf

View 2igf on RCSB PDB site
Description: crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1991-03-21, released 1992-04-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-kappa b13i2 fab (heavy chain)
    Database cross-references and differences (RAF-indexed):
    • PIR S38864 (1-220)
      • conflict (2)
      • conflict (4)
      • conflict (26)
      • conflict (30-32)
      • conflict (39)
      • conflict (41)
      • conflict (49)
      • conflict (55)
      • conflict (58)
      • conflict (62)
      • conflict (68)
      • conflict (72)
      • conflict (75)
      • conflict (79)
      • conflict (86)
      • conflict (92)
      • conflict (96)
      • conflict (98-99)
      • conflict (101-103)
      • conflict (103)
      • conflict (106)
      • conflict (113-114)
      • conflict (118-119)
      • conflict (192-193)
    Domains in SCOP 1.75: d2igfh1, d2igfh2
  • Chain 'L':
    Compound: igg1-kappa b13i2 fab (light chain)
    Database cross-references and differences (RAF-indexed):
    • PIR PC4203 (0-218)
      • conflict (25-26)
      • conflict (26)
      • conflict (26)
      • conflict (32)
      • conflict (34)
      • conflict (100)
    Domains in SCOP 1.75: d2igfl1, d2igfl2
  • Chain 'P':
    Compound: peptide (residues 69-87 of myohemerythrin)
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2igfH (H:)
    evqlvesggdlvkpggslklscaasgftfsrcamswvrqtpekrlewvagissggsytfy
    pdtvkgrfiisrnnarntlslqmsslrsedtaiyyctryssdpfyfdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2igfL (L:)
    dvlmtqtplslpvslgdqasiscrsnqtillsdgdtylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    No sequence available.