PDB entry 2igd

View 2igd on RCSB PDB site
Description: anisotropic structure of protein g igg-binding domain III at 1.1 angstrom resolution
Class: igg-binding protein
Keywords: atomic resolution, protein g, immunoglobulin-binding, igg-binding protein, transmembrane
Deposited on 1997-04-30, released 1998-07-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.097
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein g
    Species: Streptococcus sp. [TaxId:1324]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2igda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2igdA (A:)
    mtpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvt
    e