PDB entry 2igc

View 2igc on RCSB PDB site
Description: Structure of Spin labeled T4 Lysozyme Mutant T115R1A
Class: hydrolase
Keywords: Nitroxide, Spin Label, EPR, T4 Lysozyme
Deposited on 2006-09-22, released 2007-06-12
The last revision prior to the SCOP 1.73 freeze date was dated 2007-06-12, with a file datestamp of 2007-06-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.154
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Bacteriophage T4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered (53)
      • engineered (96)
      • modified residue (114)
    Domains in SCOP 1.73: d2igca1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2igcA (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagfcnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl