PDB entry 2ig3

View 2ig3 on RCSB PDB site
Description: Crystal structure of group III truncated hemoglobin from Campylobacter jejuni
Class: Oxygen storage/transport
Keywords: truncated hemoglobin, 2-on-2 globin, Oxygen storage-transport COMPLEX
Deposited on 2006-09-22, released 2006-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Group III truncated haemoglobin
    Species: Campylobacter jejuni [TaxId:197]
    Gene: ctb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ig3a_
  • Chain 'B':
    Compound: Group III truncated haemoglobin
    Species: Campylobacter jejuni [TaxId:197]
    Gene: ctb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ig3b_
  • Heterogens: CYN, ACT, SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ig3A (A:)
    mkfetinqesiaklmeifyekvrkdkdlgpifnnaigtsdeewkehkakignfwagmllg
    egdyngqplkkhldlppfpqeffeiwlklfeeslnivyneemknvilqraqmiashfqnm
    lykyggh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ig3B (B:)
    mkfetinqesiaklmeifyekvrkdkdlgpifnnaigtsdeewkehkakignfwagmllg
    egdyngqplkkhldlppfpqeffeiwlklfeeslnivyneemknvilqraqmiashfqnm
    lykyggh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ig3B (B:)
    mkfetinqesiaklmeifyekvrkdkdlgpifnnaigtsdeewkehkakignfwagmllg
    egdyngqplkkhldlppfpqeffeiwlklfeeslnivyneemknvilqraqmiashfqnm
    lyky