PDB entry 2ig2

View 2ig2 on RCSB PDB site
Description:
Deposited on 1989-04-18, released 1989-07-12
The last revision prior to the SCOP 1.69 freeze date was dated 1989-07-12, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3 Å
R-factor: 0.207
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d2ig2h1, d2ig2h2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d2ig2l1, d2ig2l2

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ig2H (H:)
    evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
    adsvkgrftisrndskntlflqmdslrpedtgvyfcardgghgfcssascfgpdywgqgt
    pvtvssastkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfp
    avlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcpa
    pellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkp
    reqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytl
    ppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflysklt
    vdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ig2H (H:)
    evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
    adsvkgrftisrndskntlflqmdslrpedtgvyfcardgghgfcssascfgpdywgqgt
    pvtvssastkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfp
    avlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ig2L (L:)
    qsvltqppsasgtpgqrvtiscsgtssnigsstvnwyqqlpgmapklliyrdamrpsgvp
    drfsgsksgasaslaigglqsedetdyycaawdvslnayvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs