PDB entry 2ig0

View 2ig0 on RCSB PDB site
Description: Structure of 53BP1/methylated histone peptide complex
Class: cell cycle
Keywords: tandem tudor domains, dimethylated histone h4, DNA repair, cell cycle regulation
Deposited on 2006-09-22, released 2007-01-02
The last revision prior to the SCOP 1.73 freeze date was dated 2007-01-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.18
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor suppressor p53-binding protein 1
    Species: HOMO SAPIENS
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ig0a1, d2ig0a2
  • Chain 'B':
    Compound: Dimethylated Histone H4-K20 peptide
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ig0A (A:)
ghmnsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipl
dtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqy
glg

    Sequence, based on observed residues (ATOM records): (download) 
    >2ig0A (A:)
sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldtev
talsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqyglg

  • Chain 'B':
    No sequence available.