PDB entry 2ifx

View 2ifx on RCSB PDB site
Description: Crystal structure of a putative 4-methylmuconolactone methylisomerase (YP_295714.1) from Ralstonia eutropha JMP134 at 2.00 A resolution
Class: Structural Genomics/Unknown function
Keywords: YP_295714.1, hypothetical protein, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, Structural Genomics-Unknown function COMPLEX
Deposited on 2006-09-21, released 2006-10-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Cupriavidus necator [TaxId:106590]
    Gene: YP_295714.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q471R3 (1-End)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (14)
      • modified residue (29)
      • modified residue (79)
    Domains in SCOPe 2.01: d2ifxa1
  • Chain 'B':
    Compound: hypothetical protein
    Species: Cupriavidus necator [TaxId:106590]
    Gene: YP_295714.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q471R3 (1-End)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (14)
      • modified residue (29)
      • modified residue (79)
    Domains in SCOPe 2.01: d2ifxb_
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ifxA (A:)
    gmirllyllvkpagmsdetfraeclrhyemshdvpglhkyevrlvaeqptdthvpffdig
    hvdaigecwfkddaayatymasdirkawfehgktfigqlkpfrtapvagdepas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ifxA (A:)
    gmirllyllvkpagmsdetfraeclrhyemshdvpglhkyevrlvaeqphvpffdighvd
    aigecwfkddaayatymasdirkawfehgktfigqlkpfrtapvag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ifxB (B:)
    gmirllyllvkpagmsdetfraeclrhyemshdvpglhkyevrlvaeqptdthvpffdig
    hvdaigecwfkddaayatymasdirkawfehgktfigqlkpfrtapvagdepas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ifxB (B:)
    gmirllyllvkpagmsdetfraeclrhyemshdvpglhkyevrlvaeqphvdaigecwfk
    ddaayatymasdirkawfehgktfigqlkpfrtapva