PDB entry 2ifw

View 2ifw on RCSB PDB site
Description: Crystal structure of scytalido-glutamic peptidase with a transition state analog inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: enzyme-inhibitor complex, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2006-09-21, released 2006-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.221
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Scytalidopepsin B
    Species: Scytalidium lignicola [TaxId:5539]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ifwa_
  • Chain 'B':
    Compound: Scytalidopepsin B
    Species: Scytalidium lignicola [TaxId:5539]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ifwb_
  • Chain 'C':
    Compound: Heptapeptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2IFW (Start-5)
  • Chain 'D':
    Compound: Heptapeptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2IFW (Start-5)
  • Heterogens: ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ifwA (A:)
tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
dgtydawyewypevsddfsgitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsn
essgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaq
itqviinnqdvtdcsvsgttvscsyv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ifwB (B:)
tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
dgtydawyewypevsddfsgitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsn
essgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaq
itqviinnqdvtdcsvsgttvscsyv

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.