PDB entry 2ifr

View 2ifr on RCSB PDB site
Description: Crystal structure of Scytalido-glutamic peptidase with a peptide based transition state analog
Class: hydrolase/hydrolase inhibitor
Keywords: enzyme-transition state analog complex, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2006-09-21, released 2006-10-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.204
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Scytalidopepsin B
    Species: Scytalidium lignicola [TaxId:5539]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ifra_
  • Chain 'B':
    Compound: Octapeptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2IFR
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ifrA (A:)
    tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
    dgtydawyewypevsddfsgitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsn
    essgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaq
    itqviinnqdvtdcsvsgttvscsyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ifrA (A:)
    tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
    dgtydawyewypevsddfitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsnes
    sgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaqit
    qviinnqdvtdcsvsgttvscsyv
    

  • Chain 'B':
    No sequence available.