PDB entry 2iff

View 2iff on RCSB PDB site
Description: structure of an antibody-lysozyme complex: effect of a conservative mutation
Class: immunoglobulin/hydrolase(o-glycosyl)
Keywords: IMMUNOGLOBULIN/HYDROLASE(O-GLYCOSYL), IMMUNOGLOBULIN-HYDROLASE(O-GLYCOSYL) complex
Deposited on 1994-02-03, released 1994-05-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1 hyhel-5 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IFF (Start-214)
    Domains in SCOPe 2.06: d2iffh1, d2iffh2
  • Chain 'L':
    Compound: igg1 hyhel-5 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB34980 (1-211)
      • conflict (17)
      • conflict (25)
      • conflict (29)
      • conflict (32)
      • conflict (58)
      • conflict (78)
      • conflict (90-92)
      • conflict (110)
    Domains in SCOPe 2.06: d2iffl1, d2iffl2
  • Chain 'Y':
    Compound: hen egg white lysozyme
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • conflict (67)
    Domains in SCOPe 2.06: d2iffy_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2iffH (H:)
    xvqlqqsgaelmkpgasvkisckasgytfsdywiewvkqrpghglewigeilpgsgstny
    herfkgkatftadtssstaymqlnsltsedsgvyyclhgnydfdgwgqgttltvssaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpssprpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iffH (H:)
    vqlqqsgaelmkpgasvkisckasgytfsdywiewvkqrpghglewigeilpgsgstnyh
    erfkgkatftadtssstaymqlnsltsedsgvyyclhgnydfdgwgqgttltvssakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iffL (L:)
    divltqspaimsaspgekvtmtcsasssvnymywyqqksgtspkrwiydtsklasgvpvr
    fsgsgsgtsysltissmetedaatyycqqwgrnptfgggtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iffY (Y:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
    rwwcndgktpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl