PDB entry 2ifd

View 2ifd on RCSB PDB site
Description: Crystal structure of a remote binding site mutant, R492L, of CDC25B Phosphatase catalytic domain
Class: hydrolase
Keywords: phosphatase, dual specificity, hydrolase
Deposited on 2006-09-20, released 2007-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: M-phase inducer phosphatase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC25B, CDC25HU2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30305 (1-174)
      • initiating methionine (0)
      • engineered (116)
    Domains in SCOPe 2.08: d2ifda_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ifdA (A:)
    meligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyegg
    hiktavnlplerdaesfllkspiapcsldkrvilifhcefssergprmcrfirerdlavn
    dypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw