PDB entry 2ifa

View 2ifa on RCSB PDB site
Description: Crystal Structure of the PUTATIVE NITROREDUCTASE (SMU.260) IN COMPLEX WITH FMN FROM STREPTOCOCCUS MUTANS, NORTHEAST STRUCTURAL GENOMICS TARGET SMR5.
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-09-20, released 2006-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein SMU.260
    Species: Streptococcus mutans [TaxId:210007]
    Gene: SMU.260
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW21 (Start-199)
      • modified residue (144)
      • modified residue (169)
      • modified residue (188)
      • expression tag (200)
    Domains in SCOPe 2.08: d2ifaa1, d2ifaa2
  • Chain 'B':
    Compound: Hypothetical protein SMU.260
    Species: Streptococcus mutans [TaxId:210007]
    Gene: SMU.260
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW21 (Start-199)
      • modified residue (144)
      • modified residue (169)
      • modified residue (188)
      • expression tag (200-201)
    Domains in SCOPe 2.08: d2ifab2, d2ifab3
  • Chain 'C':
    Compound: Hypothetical protein SMU.260
    Species: Streptococcus mutans [TaxId:210007]
    Gene: SMU.260
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW21 (Start-199)
      • modified residue (144)
      • modified residue (169)
      • modified residue (188)
      • expression tag (200-201)
    Domains in SCOPe 2.08: d2ifac2, d2ifac3
  • Chain 'D':
    Compound: Hypothetical protein SMU.260
    Species: Streptococcus mutans [TaxId:210007]
    Gene: SMU.260
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW21 (Start-199)
      • modified residue (144)
      • modified residue (169)
      • modified residue (188)
      • expression tag (200)
    Domains in SCOPe 2.08: d2ifad2, d2ifad3
  • Chain 'E':
    Compound: Hypothetical protein SMU.260
    Species: Streptococcus mutans [TaxId:210007]
    Gene: SMU.260
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW21 (Start-199)
      • modified residue (144)
      • modified residue (169)
      • modified residue (188)
      • expression tag (200-201)
    Domains in SCOPe 2.08: d2ifae2, d2ifae3
  • Chain 'F':
    Compound: Hypothetical protein SMU.260
    Species: Streptococcus mutans [TaxId:210007]
    Gene: SMU.260
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DW21 (Start-199)
      • modified residue (144)
      • modified residue (169)
      • modified residue (188)
    Domains in SCOPe 2.08: d2ifaf_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ifaA (A:)
    msnfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqd
    fwnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfq
    pwseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsie
    apagekefmadqerfkvfgdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ifaA (A:)
    snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
    wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
    wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
    pagekefmadqerfkvfgdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ifaB (B:)
    msnfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqd
    fwnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfq
    pwseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsie
    apagekefmadqerfkvfgdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ifaB (B:)
    snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
    wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
    wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
    pagekefmadqerfkvfgdle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ifaC (C:)
    msnfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqd
    fwnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfq
    pwseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsie
    apagekefmadqerfkvfgdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ifaC (C:)
    snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
    wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
    wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
    pagekefmadqerfkvfgdle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ifaD (D:)
    msnfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqd
    fwnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfq
    pwseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsie
    apagekefmadqerfkvfgdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ifaD (D:)
    snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
    wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
    wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
    pagekefmadqerfkvfgdl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ifaE (E:)
    msnfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqd
    fwnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfq
    pwseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsie
    apagekefmadqerfkvfgdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ifaE (E:)
    snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
    wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
    wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
    pagekefmadqerfkvfgdle
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ifaF (F:)
    msnfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqd
    fwnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfq
    pwseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsie
    apagekefmadqerfkvfgdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ifaF (F:)
    snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
    wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
    wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
    pagekefmadqerfkvfgd