PDB entry 2if1

View 2if1 on RCSB PDB site
Description: human translation initiation factor eif1, nmr, 29 structures
Class: translation initiation factor
Keywords: translation initiation factor
Deposited on 1998-08-04, released 1999-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: eif1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41567 (13-125)
  Domains in SCOPe 2.08: d2if1a1, d2if1a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2if1A (A:)
  mrgshhhhhhtdpmsaiqnlhsfdpfadaskgddllpagtedyihiriqqrngrktlttv
  qgiaddydkkklvkafkkkfacngtviehpeygeviqlqgdqrknicqflveiglakddq
  lkvhgf