PDB entry 2ier

View 2ier on RCSB PDB site
Description: Crystal Structure of Aquifex aeolicus LpxC Complexed with Uridine 5'-Diphosphate
Class: hydrolase
Keywords: alpha + beta fold
Deposited on 2006-09-19, released 2007-01-09
The last revision prior to the SCOP 1.73 freeze date was dated 2007-01-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
    Species: Aquifex aeolicus
    Gene: lpxc
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67648
      • engineered (180)
    Domains in SCOP 1.73: d2iera1, d2iera2
  • Chain 'B':
    Compound: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
    Species: Aquifex aeolicus
    Gene: lpxc
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67648
      • engineered (180)
    Domains in SCOP 1.73: d2ierb1, d2ierb2
  • Heterogens: ZN, UDP, PLM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ierA (A:)
    mglektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhst
    dlgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnre
    idyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartf
    afdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgs
    pvkgkfysfrgghslnvklvkelakkqkltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ierA (A:)
    glektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstd
    lgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnrei
    dyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfa
    fdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgsp
    vkgkfysfrgghslnvklvkelakkqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ierB (B:)
    mglektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhst
    dlgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnre
    idyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartf
    afdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgs
    pvkgkfysfrgghslnvklvkelakkqkltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ierB (B:)
    glektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstd
    lgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnrei
    dyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfa
    fdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgsp
    vkgkfysfrgghslnvklvkelakkqk