PDB entry 2iem

View 2iem on RCSB PDB site
Description: Solution structure of an oxidized form (Cys51-Cys198) of E. coli Methionine Sulfoxide Reductase A (MsrA)
Class: oxidoreductase
Keywords: Methionine Sulfoxide Reductase A, NMR solution 3D structure, dynamics, catalytic mechanism, intramolecular disulfide bond formation, OXIDOREDUCTASE
Deposited on 2006-09-19, released 2007-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptide methionine sulfoxide reductase msrA
  Species: Escherichia coli [TaxId:562]
  Gene: msrA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A744 (0-210)
    • engineered (85)
    • engineered (205)
  Domains in SCOPe 2.07: d2iema_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2iemA (A:)
  slfdkkhlvspadalpgrntpmpvatlhavnghsmtnvpdgmeiaifamgcfwgverlfw
  qlpgvystaagytggytpnptyrevssgdtghaeavrivydpsvisyeqllqvfwenhdp
  aqgmrqgndhgtqyrsaiypltpeqdaaaraslerfqaamlaadddrhitteianatpfy
  yaeddhqqylhknpygycgiggigvslppea