PDB entry 2iek

View 2iek on RCSB PDB site
Description: New crystal form of transcriptional regulator tm1030 from Thermotoga maritima
Class: transcription
Keywords: transcriptional regulator; tetr family
Deposited on 2006-09-19, released 2007-08-28
The last revision prior to the SCOP 1.75 freeze date was dated 2007-08-28, with a file datestamp of 2007-08-24.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.222
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TRANSCRIPTIONAL REGULATOR, TetR FAMILY
    Species: THERMOTOGA MARITIMA
    Gene: tm1030
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ieka1, d2ieka2
  • Heterogens: P2K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iekA (A:)
    mlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvte
    klqkefenflmknrnrdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilld
    leksqrvffdfvreklkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdm
    ntlveevkvmlrilkkgmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iekA (A:)
    lskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvtek
    lqkefenflmknrnrdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilldl
    eksqrvffdfvreklkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdmn
    tlveevkvmlrilkkgmtk