PDB entry 2ieh

View 2ieh on RCSB PDB site
Description: Crystal structure of human kinesin Eg5 in complex with (R)-mon97, a new monastrol-based inhibitor that binds as (R)-enantiomer
Class: hydrolase
Keywords: beta-sheet core, flanked by three alpha-helices on each side, HYDROLASE
Deposited on 2006-09-19, released 2007-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-05-13, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.234
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ieha_
  • Chain 'B':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2iehb_
  • Heterogens: MG, K, CL, ADP, MOY, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iehA (A:)
    asqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladks
    srktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegersp
    neeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvser
    lqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsv
    tihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvita
    lvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahrakniln
    kpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iehA (A:)
    kgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfga
    stkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplag
    iiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgv
    iikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgee
    lvkigklnlvdlagseninqslltlgrvitalvertphvpyreskltrilqdslggrtrt
    siiatispaslnleetlstleyahraknilnkpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iehB (B:)
    asqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladks
    srktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegersp
    neeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvser
    lqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsv
    tihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvita
    lvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahrakniln
    kpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iehB (B:)
    gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgas
    tkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagi
    iprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvi
    ikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeel
    vkigklnlvdlagseninqslltlgrvitalvertphvpyreskltrilqdslggrtrts
    iiatispaslnleetlstleyahraknilnkpevn