PDB entry 2ieg

View 2ieg on RCSB PDB site
Description: Crystal structure of rabbit muscle glycogen phosphorylase in complex with 3,4-dihydro-2-quinolone
Class: transferase
Keywords: glycogen phosphorylase, glypho, diabetes, transferase
Deposited on 2006-09-19, released 2006-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.23
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • conflict (379)
    Domains in SCOPe 2.07: d2iega_
  • Chain 'B':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • conflict (379)
    Domains in SCOPe 2.07: d2iegb_
  • Heterogens: PLR, FRY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iegA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iegA (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapngg
    yiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksnfdafpdk
    vaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvipealerwpvhll
    etllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciagshav
    ngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerigeeyi
    sdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvkrihe
    ykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigdvvnh
    dpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngaltigtm
    dganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssgffsp
    kqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniatsgkfs
    sdrtiaqyareiwgvepsrqrlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iegB (B:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iegB (B:)
    rkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwir
    tqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieeda
    glgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpw
    ekarpeftlpvhfygrvehtgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
    gyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkstnfdafp
    dkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvipealerwpvh
    lletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciagsh
    avngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerigee
    yisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvkri
    heykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigdvv
    nhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngaltig
    tmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssgff
    spkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniatsgk
    fssdrtiaqyareiwgvepsrqrlp