PDB entry 2ief

View 2ief on RCSB PDB site
Description: Structure of the cooperative Excisionase (Xis)-DNA complex reveals a micronucleoprotein filament
Class: DNA binding protein/DNA
Keywords: Excisionase; Recombination Directionality Factor; Site Specific Recombination; Micronucleoprotein Filament
Deposited on 2006-09-18, released 2007-02-06
The last revision prior to the SCOP 1.73 freeze date was dated 2007-03-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.201
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Excisionase
    Species: Bacteriophage lambda
    Gene: Xis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03699 (0-54)
      • engineered (27)
    Domains in SCOP 1.73: d2iefa1
  • Chain 'B':
    Compound: Excisionase
    Species: Bacteriophage lambda
    Gene: Xis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03699 (0-End)
      • engineered (27)
    Domains in SCOP 1.73: d2iefb1
  • Chain 'C':
    Compound: Excisionase
    Species: Bacteriophage lambda
    Gene: Xis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03699 (0-End)
      • engineered (27)
    Domains in SCOP 1.73: d2iefc1
  • Chain 'D':
    Compound: 15-mer DNA
  • Chain 'E':
    Compound: 19-mer DNA
  • Chain 'F':
    Compound: 34-mer DNA
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iefA (A:)
    myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iefB (B:)
    myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iefB (B:)
    myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2iefC (C:)
    myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iefC (C:)
    myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdln
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.