PDB entry 2ief
View 2ief on RCSB PDB site
Description: Structure of the cooperative Excisionase (Xis)-DNA complex reveals a micronucleoprotein filament
Class: DNA binding protein/DNA
Keywords: Excisionase; Recombination Directionality Factor; Site Specific Recombination; Micronucleoprotein Filament, DNA BINDING PROTEIN-DNA COMPLEX
Deposited on
2006-09-18, released
2007-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.201
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Excisionase
Species: Enterobacteria phage lambda [TaxId:10710]
Gene: Xis
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2iefa_ - Chain 'B':
Compound: Excisionase
Species: Enterobacteria phage lambda [TaxId:10710]
Gene: Xis
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2iefb_ - Chain 'C':
Compound: Excisionase
Species: Enterobacteria phage lambda [TaxId:10710]
Gene: Xis
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2iefc_ - Chain 'D':
Compound: 15-mer DNA
- Chain 'E':
Compound: 19-mer DNA
- Chain 'F':
Compound: 34-mer DNA
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2iefA (A:)
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2iefB (B:)
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp
Sequence, based on observed residues (ATOM records): (download)
>2iefB (B:)
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnr
- Chain 'C':
Sequence, based on SEQRES records: (download)
>2iefC (C:)
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp
Sequence, based on observed residues (ATOM records): (download)
>2iefC (C:)
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdln
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.