PDB entry 2ie8

View 2ie8 on RCSB PDB site
Description: Crystal structure of Thermus caldophilus phosphoglycerate kinase in the open conformation
Class: Transferase
Keywords: Crystal structure, Domain movement, Phosphoglycerate kinase, Thermus caldophilus, Transferase
Deposited on 2006-09-18, released 2006-11-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate kinase
    Species: Thermus caldophilus [TaxId:272]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08GC7 (2-389)
      • cloning artifact (0-1)
    Domains in SCOPe 2.01: d2ie8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ie8A (A:)
    yatlldldpkgkrvlvrvdynvpvqdgkvqdetrileslptlrhllaggaslvllshlgr
    pkgpdpryslapvgealrahlpearfapfppgseearreaealrpgevlllenvrfepge
    ekndpelsaryarlgeafvldafgsahrahasvvgvarllpayagflmekevralsrllk
    dperpyavvlggakvsdkigviesllpridrlliggamaftflkalggevgrslveedrl
    dlakdllgraealgvrvylpedvvaaerieagvetrvfparaipvpymgldigpktreaf
    aralegartvfwngpmgvfevppfdegtlavgqaiaalegaftvvgggdsvaavnrlglk
    erfghvstgggasleflekgtlpglevleg