PDB entry 2ie4

View 2ie4 on RCSB PDB site
Description: Structure of the Protein Phosphatase 2A Core Enzyme Bound to okadaic acid
Class: signaling protein,hydrolase
Keywords: protein-protein complex, HEAT repeat, SIGNALING PROTEIN,HYDROLASE
Deposited on 2006-09-17, released 2006-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.27
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Phosphatase 2, regulatory subunit A (PR 65), alpha isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP2R1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ie4a_
  • Chain 'C':
    Compound: Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP2CA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ie4c1
  • Heterogens: MN, OKA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ie4A (A:)
    maaadgddslypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiy
    dedevllalaeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehs
    psdleahfvplvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpm
    vrraaasklgefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedl
    ealvmptlrqaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevra
    aashkvkefcenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdn
    tiehllplflaqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvr
    laiieympllagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewaha
    tiipkvlamsgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnv
    akslqkigpildnstlqsevkpilekltqdqdvdvkyfaqealtvlsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ie4A (A:)
    slypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiydedevlla
    laeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehspsdleahf
    vplvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmvrraaask
    lgefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedlealvmptl
    rqaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraaashkvke
    fcenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdntiehllpl
    flaqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrlaiieymp
    llagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahatiipkvla
    msgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnvakslqkig
    pildnstlqsevkpilekltqdqdvdvkyfaqealtvlsla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ie4C (C:)
    mdekvftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhg
    qfhdlmelfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhes
    rqitqvygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhi
    raldrlqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsra
    hqlvmegynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpaprrgephv
    trrtpdyfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ie4C (C:)
    ftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgqfhdl
    melfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesrqitq
    vygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhiraldr
    lqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrahqlvm
    egynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpap