PDB entry 2ie2

View 2ie2 on RCSB PDB site
Description: The 1.7 A crystal structure of Dronpa: a photoswitchable green fluorescent protein
Class: luminescent protein
Keywords: beta barrel, luminescent protein
Deposited on 2006-09-16, released 2006-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (61)
    Domains in SCOPe 2.07: d2ie2a_
  • Chain 'B':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (61)
    Domains in SCOPe 2.07: d2ie2b_
  • Chain 'C':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (61)
    Domains in SCOPe 2.07: d2ie2c_
  • Chain 'D':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (61)
    Domains in SCOPe 2.07: d2ie2d_
  • Chain 'E':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (61)
    Domains in SCOPe 2.07: d2ie2e_
  • Chain 'F':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (61)
    Domains in SCOPe 2.07: d2ie2f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ie2A (A:)
    msvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttv
    fcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirf
    dgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykak
    kvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ie2A (A:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ie2B (B:)
    msvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttv
    fcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirf
    dgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykak
    kvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ie2B (B:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ie2C (C:)
    msvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttv
    fcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirf
    dgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykak
    kvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ie2C (C:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfc
    ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
    vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
    vqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ie2D (D:)
    msvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttv
    fcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirf
    dgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykak
    kvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ie2D (D:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ie2E (E:)
    msvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttv
    fcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirf
    dgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykak
    kvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ie2E (E:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ie2F (F:)
    msvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttv
    fcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirf
    dgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykak
    kvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ie2F (F:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs