PDB entry 2idt

View 2idt on RCSB PDB site
Description: Structure of M98Q mutant of amicyanin, Cu(II)
Class: electron transport
Keywords: blue copper protein; beta sandwich, ELECTRON TRANSPORT
Deposited on 2006-09-15, released 2007-03-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.126
AEROSPACI score: 1.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: mauC, ami
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22364 (0-104)
      • modified residue (50)
      • engineered (97)
    Domains in SCOPe 2.01: d2idta_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2idtA (A:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfqrgkvvve