PDB entry 2idr

View 2idr on RCSB PDB site
Description: Crystal structure of translation initiation factor EIF4E from wheat
Class: translation regulator
Keywords: eukaryotic initiation factor 4e, eif4e, translation regulator
Deposited on 2006-09-15, released 2007-06-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.211
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic translation initiation factor 4E-1
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2idra_
  • Chain 'B':
    Compound: Eukaryotic translation initiation factor 4E-1
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2idrb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2idrA (A:)
ahplenawtfwfdnpqgksrqvawgstihpihtfstvedfwglynnihnpsklnvgadfh
cfknkiepkwedpicanggkwtiscgrgksdtfwlhtllamigeqfdfgdeicgavvsvr
qkqervaiwtknaaneaaqisigkqwkefldykdsigfivhedakrsdkgpknrytv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2idrB (B:)
ahplenawtfwfdnpqgksrqvawgstihpihtfstvedfwglynnihnpsklnvgadfh
cfknkiepkwedpicanggkwtiscgrgksdtfwlhtllamigeqfdfgdeicgavvsvr
qkqervaiwtknaaneaaqisigkqwkefldykdsigfivhedakrsdkgpknrytv