PDB entry 2ido

View 2ido on RCSB PDB site
Description: Structure of the E. coli Pol III epsilon-Hot proofreading complex
Class: transferase
Keywords: Polymerase, exonuclease, Hot, epsilon, Pol III, TRANSFERASE
Deposited on 2006-09-15, released 2006-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase III epsilon subunit
    Species: Escherichia coli [TaxId:562]
    Gene: dnaQ, mutD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2idoa_
  • Chain 'B':
    Compound: Hot protein
    Species: Enterobacteria phage [TaxId:10678]
    Gene: hot
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2idob_
  • Chain 'C':
    Compound: DNA polymerase III epsilon subunit
    Species: Escherichia coli [TaxId:562]
    Gene: dnaQ, mutD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2idoc_
  • Chain 'D':
    Compound: Hot protein
    Species: Enterobacteria phage [TaxId:10678]
    Gene: hot
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2idod_
  • Heterogens: MN, TMP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2idoA (A:)
    mstaitrqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdp
    eafgvhgiadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipk
    tntfckvtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg
    gqtsma
    

    Sequence, based on observed residues (ATOM records): (download)
    >2idoA (A:)
    trqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafgv
    hgiadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntfc
    kvtdslavarkmfpgkrnsldalcaryeidnsrlhgalldaqilaevylamtg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2idoB (B:)
    mydwniaaksqeerdkvnvdlaasgvaykerlnipviaeqvareqpenlrtyfmerlrhy
    rqlslqlpkgsdpayqkddavkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2idoB (B:)
    ydwniaaksqeerdkvnvdlaasgvaykerlnipviaeqvareqpenlrtyfmerlrhyr
    qlslqlpkgsdpayq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2idoC (C:)
    mstaitrqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdp
    eafgvhgiadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipk
    tntfckvtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg
    gqtsma
    

    Sequence, based on observed residues (ATOM records): (download)
    >2idoC (C:)
    trqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafgv
    hgiadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntfc
    kvtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2idoD (D:)
    mydwniaaksqeerdkvnvdlaasgvaykerlnipviaeqvareqpenlrtyfmerlrhy
    rqlslqlpkgsdpayqkddavkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2idoD (D:)
    mydwniaaksqeerdkvnvdlaasgvaykerlnipviaeqvareqpenlrtyfmerlrhy
    rqlslqlpkgsdpayq