PDB entry 2idl

View 2idl on RCSB PDB site
Description: Crystal Structure of Conserved Protein of Unknown Function from Streptococcus pneumoniae
Class: structural genomics, unknown function
Keywords: conserved hypothetical, MCSG, PSI2, MAD, structural genomics, Protein Structure Initiative, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2006-09-15, released 2006-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.171
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97QU3 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d2idla1, d2idla2
  • Chain 'B':
    Compound: hypothetical protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97QU3 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d2idlb2, d2idlb3
  • Heterogens: NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2idlA (A:)
snamiqavferaedgelrsaeitghaesgeygldvvcasvstlainfinsiekfagyepi
lelnedeggylmveipkdlpshqremtqlffesfflgmanlsenysefvqtrviten

    Sequence, based on observed residues (ATOM records): (download) 
    >2idlA (A:)
amiqavferaedgelrsaeitghaesgeygldvvcasvstlainfinsiekfagyepile
lnedeggylmveipkdlpshqremtqlffesfflgmanlsenysefvqtrvit

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2idlB (B:)
snamiqavferaedgelrsaeitghaesgeygldvvcasvstlainfinsiekfagyepi
lelnedeggylmveipkdlpshqremtqlffesfflgmanlsenysefvqtrviten

    Sequence, based on observed residues (ATOM records): (download) 
    >2idlB (B:)
snamiqavferaedgelrsaeitghaesgeygldvvcasvstlainfinsiekfagyepi
lelnedeggylmveipkdlpshqremtqlffesfflgmanlsenysefvqtrvite