PDB entry 2idk

View 2idk on RCSB PDB site
Description: Crystal Structure of Rat Glycine N-Methyltransferase Complexed With Folate
Class: transferase
Keywords: Glycine N-Methyltransferase, rat, folate binding, transferase
Deposited on 2006-09-15, released 2006-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine n-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: GNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2idka_
  • Chain 'B':
    Compound: glycine n-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: GNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2idkb_
  • Chain 'C':
    Compound: glycine n-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: GNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2idkc_
  • Chain 'D':
    Compound: glycine n-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: GNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2idkd_
  • Heterogens: C2F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2idkA (A:)
    vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
    dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrl
    syyphclasftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2idkA (A:)
    dsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrvl
    dvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltld
    kdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhrnydyil
    stgcappgkniyykskdittsvltvnnkahmvtldytvqfskfrlsyyphclasftelvq
    eafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2idkB (B:)
    vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
    dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrl
    syyphclasftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2idkB (B:)
    vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
    dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgafskfrlsyyphcl
    asftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2idkC (C:)
    vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
    dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrl
    syyphclasftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2idkC (C:)
    vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
    dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqfskfrlsyyphclasft
    elvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2idkD (D:)
    vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
    dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrl
    syyphclasftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2idkD (D:)
    vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
    dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgapgfskfrlsyyph
    clasftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg