PDB entry 2idc

View 2idc on RCSB PDB site
Description: Structure of the Histone H3-Asf1 Chaperone Interaction
Class: Replication/Chaperone
Keywords: Ig-like fold, Asf1, H3, histone, chaperone, chromatin, Replication-Chaperone COMPLEX
Deposited on 2006-09-14, released 2007-01-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-silencing protein 1 and Histone H3 Chimera
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ASF1 and HHT1, SIN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32447 (3-156)
      • cloning artifact (2)
      • see remark 999 (157-158)
      • conflict (167)
    • Uniprot P61830
    Domains in SCOPe 2.03: d2idca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2idcA (A:)
    snasivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeld
    silvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneyd
    eeelrenppakvqvdhivrnilaekprvtrfnivwdnaagaataakkeiklarrlrger
    

    Sequence, based on observed residues (ATOM records): (download)
    >2idcA (A:)
    asivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsi
    lvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydee
    elrenppakvqvdhivrnilaekprvtrfnivwdnaakeiklarrlr