PDB entry 2ida

View 2ida on RCSB PDB site
Description: Solution NMR Structure of Protein RPA1320 from Rhodopseudomonas Palustris. Northeast Structural Genomics Consortium Target RpT3; Ontario Center for Structural Proteomics Target RP1313.
Class: structural genomics, unknown function
Keywords: Zinc binding protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-09-14, released 2006-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: RPA1320
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2idaa1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2idaA (A:)
mtmgcrhvagirtvtpsalgceeclkigspwvhlricrtcghvgccddsphkhatrhfha
tghpiiegydppegwgwcyvdevmfdlsdrmtphngpipryv